'VV"œBhiboot` @xV44ma $xJ %4mt 6.p=P(  A q@% (P&`B1D,4 T ''  AD&6,"p0 4I 8(A$<@@gdphKp"p?p?L<<HH ]xp@xx@xx@pp@pph (048 < @ D HLPT X \`d           00XX  $   $  ,,44 +} Txx    $(,04 DHL PTdhlptx|XLXPPX(8( @$ @( @, @0 @4 @H HP \ H` (d (h (l (@@ﾭﾭƒ<)   @'Q @|p@6֟@РD / P b`V< hF 0@0 o/P <0@OA֟ O @, PO @P !1 C Pڰ@@ @ P5 MMOР iHMD"'B B H4P E M|@@OЍHM"'B B H4P 6 MMOР iHM#'B B H4P ' 4MMOР iHMd#'B B H4P  MMOР iHM#'B B H4P MMOР iHM$$'B B H4P  TMMOР iHM$'B B H4P  ^-pPp`W 004; 0Q@ /0  XBA_oPrvVYpW S@ R`$0S!0S  \o Q 1 @ A@ TD> PŠ@D\@̅S 0S R Q0  @ A@ TD> PŠ@D\@̅S 0SS 0SS 0S>G I@tP嬍pG T< US 0S>G I@PH} T< US 0S /ujiz@ R/" 2RRR,SSS</| PQRS /12,3<! 00 0#P//0(20" 0O?/0S/@-@ \\\ S   ^!^ 0b \0 8< 0 40Ѝ00/0/p0&6p p00)9 0O/S??ÓÓ $#RN-@!`P B U70뤰OppW0 #.P  Y QP UYP % 0PUЍ-#^\!./\/".0130S\!\" !0/PP/8@-PP0@S20C6>0 010Cd0U 80C000000<0008O00,00000000008mmmmUU1@-O@00SS 0$  P# !r 0Rl0B‚1B!1! q 0(01s `@-@0 S 0" "," 10?qQ 0S  0N-P@` ᴴAᰤ嬔t[P;:9$7D{zr +)(:74;2$`qpr s0\P$ 41"(0q2$p3Dr t0`JЍ@-0S`@` pP0SP0p  LS@N-M8@p piD0 p00 [ [ [PPD0 0P!D0 0 0 0pY W  D0 p 0 0  ЍF-@$M偡`Pp P 0 0"0PP p0s  0  000ppG 0"PP p}QAp 0\ PP 000 0"PP paQp 0@ 4P 00C0p  0 A00 c 0( $ЍN-@P`p1A 0 0 0+0  s0#[Z@D [   0p@ 0usp0  1 @TW㩑0?~ЍSN-000[0`P??pこ Y @0WD[  P P0 PP0@* P0`(PZ& [Z@@cTZ@c@T 0B lP  07 ЍN_p0Ѝp@-P`P@p0T  P P @p0F-P`p@0U P*@TZ@  @-GMP@p```0F/p`` D0 0` 00 0p pGߍF-IM@`?0. `@P000000.0U+*0@ㅒp 0 0 _10s#8 0p  @TP0 0  0  0\IߍN-M@PPd ?0 0" p  [B hÅ? 0 0  `,    0B  \0PY0CoY `VY``j` `  0 )pi0,2WSp 0 "S dqЍN-XM@`~8 0 pP#R0 ^   d ! 0 40#Z P R B  $#0  d0 #2pq0W2 00p4  #S  0c  0R  P \K0c à4XQb00p 0YP`SPe!0 9p 01W`p#Y#V`#*Pc!0 ! 0WpepY eV`e` x\ 0 010#442Xrb7XЍN-8M@/0PS0p⏿`<0V 0 YT $ I Pa  렐0$ S0`0J0  pWt W  τ0S  P聀0 `@V@V㠐 0`V  0` 00/ S Ñ@?0S 0` 8Ѝ1N-Aa29Cp,P倡0sj pt8p00  0}|P@p>0h1 a@nP<00 0@T P@"\PU0 QYU အ0@v@ GP  0@g@ 9PhpdU>L01D0 QaU〡@$0Tp ////////d00S 0/N-P `P0@p0 7C00(00X0},0@TS S600pS S6PP0 PtPp`QP}\0ZS S6p`0`S S6@@$0p`a`0`PÃL0H0QDQ<<I1R 0, GR$ $  P ÃtXL`8$F-P 〠@|0p`P0h0(0},0YS S6`00PS S6p@@$0`PQP0PÃ(0 $0AR R  P ^ÃK7#@-`JP 0$( /!5@P@-P}_|xV4@-  1낀傀0@-DMD@ M&P@P  }DЍ0 낀/////////@-0낀,1p@-0C H Q{ H  {0`    b @T 4/P @1 0J W6P%xzC@t7?1qh%P  ?}P0L%P @ P5pMI=T}XÃ?낀F낀LO낀烀//@- <@jX낀0@-M@ a{00<8 0,0@P040q0($ 0l00 00e00  00^0z Z c0C0vVUnNO0@0TP  @0 1400?0Ѝ0ȱo낀낀낀삀8삀k낀(?t H삀@-@/0@g삀@-@&0@~삀@-@0@삀@-@0@삀@-@ 0@}삀@-@0}@t삀@-@/t@k삀s@-@`PT  |pT @0S@PUЍp@-@ %0  0 0 0 0  @-M @l~$Ѝ킀40P@- M @ \~  Ѝ킀킀@-?=0 / Ã/ z@- 0  Ã@-  wz0 Q   Ѝ Ã8@-$@PP yP yP yP  | 000P0 0}70@0080S:C 0 8킀 Ã킀킀킀::0/ Ã8@-PP@ P8 \P8 Ã0Q A0#(s0#(sp/@-?0o,00?s0S0S0S/$~@-o0p @P?_uPUPUPy LuPyUw "4$ 00"4_$P!$~(Ãs@-(P$`< @0`  0 `y(0 0! y0(000000,00 ! 40S@.,08080 0!y$`vЍp Ã&~킀@-\@,0Sʈ< P3 bR@00@01S .0@0@<@ Ã@- QpD@J}yT`0+P@,0oE0(@0`;` 0X0 X s0#$4s00@0000 p` /0p15a a?1% T0@pp@c@`@n<\ ÃN- QuPdh>%`?o v`/p Pr  R  Vʴa@Aov` V@A QPP a@0Ao?S0v`^p P SR0s0S 8V 50Vb  VQ_ڰ0?s0S0?s0 SZ R(0帓S  x(0 R0?s0S S  `<0 p@x 8 x(1e,0RS P0S  x80 R PxP TxT`i0,0`0P0Qʄ 00?s0S 0?s0S0?s0 S 4R 0*,l0S mx 0rQqṟy Q w-h0 @Rd0Sa 6P_-Y  Hx( 0R S sL`oV`VG 0S5Q Q Q= 070S5@-1p  x p x `` I`aS 1!?/s0q0Cr r Xr000Sc(_(1Z(0S 10S !  0R P( Q;(0SG(Q tA(h!p ((0S H 4(0< "R%.(,(1((( &(00140S6S !S000#5PE0P0"㫔 PPPPr 0P ! 000SC.!,&(011p郀`_@-$@PP郀8@-R0|P%Q 0Q%|%xxp8@%RQ@ 0QL H%@%8@i,,8@%郀,󂀊Dk󂀕󂀨傀/S<00$0@- P^ 0@p\ @ ^^018@-Q@P X1%0  X10$X18 0X!<05X!<0C SS$- v%UX1\1p8Hp@-`0@S$PP X1U  $  X1%0 X1< 5X!<0C SS F%p13/pg8@-P@X1 @@  X1 $  X1%0 X1< 5X!<0C SS{ %8p@-`@@xPpWp@TK 0%p󂀘p@-P0@S``^PZ VX1" $  X1%0 X1< 5X!<0C SS= $=05F $0f $  X1%0 X1< 5X!<0C SSV $X1 $  X1%0 X1< 5X!<0C SS d $p13/p󂀯/@-P$1`@00S>3S8 V\1  pX1$  X1%0  X18 X1< 5X!<0C SSpP l^$p13/003/3S 0a$_ 0H$Ѝp̲ԲZ00Cs0S/$00Cs0S/B-@2P05`v`0pSu 003/\1V pp\1wppX1$  X1%0  X18 X1< 5X!<0C SS@I <#003/5WP? Q003/5H\1V1 pX1$  X1%0  X18 X1< 5X!<0C SS`~ \#003/50S 1$ 0#Ѝ̲,1@-@M0PX`v`P3pS6 003/\1V@ppwppX!0$0X!0X!80 X1< 5X!<0C SS`E \l#003/P3S 1$N 0Z#Ѝ̲@-P@ 5`v`0pS% 003/\1V1 ppwppX1$  X1%0  X18 X1< 5X!<0C SS  #B-@<1P05`xv`0pS= p003/\1V pp\1wppX1$  X1%0  X18 X1< 5X!<0C SS`!\"003/5@0S 1$&!0"Ѝ̲7 @-00\Q@T @m0 SN-Mp`x#yPU  0   P |, ?q$Cp PDR   mP PZ  Q P!@@Z T *0 |0 @ Rqt@p|h"0 D@0 ? 0000|000 0 $ 0 @D@0!R $P 10$00,⁅0!R Q 1000 s8q000003/H1H!0300S003/  ""!0S!00@@00000 0 0S!'(0!p 0(00 l4 k0C00 `000 00 0Y"Ѝ숀P~U!P냀 'DXX1Q ++ /p@-XSP X,LN@M S@B@A@<`@0`05B,` āeXaB0X@@XL X!hX!0CSSp N p@v!V傀N-0p MRP@ e!vW ]!naP V!dl(00:000003/P  hC!00C0Pl1@3/ QT:0@b`S  *!l13/Q dPd 1 `0l?Vh!0 W d @kjF V h!0`@F d k fZ p 0  B Ѝ傀숀DN-0 `Rp(P4r!0Y$w! 1S x1Q* ~! s䱟P  dliꟃ000003/P Y0W@03/l1L3/TB Jd T @! QW-:0pbS8!4 003/P003/l1$3/003/P003/l1$3/0SW* Y @1J#  dJk@h!0p dY0p`S@!<Q 00C0 ЍO 悀qx숀DN-` p(Qj"8  B o"- /!R x!V* {"ꤱP  d_k  ZK @0UT `d QD"@ 2/0P >!00C0  2/l!02/1X!0$X!,`2 0  %#X!0X!<0%X< B RR `[!T0 0C04 ` b悀Jxy숀D0悀8@-P@ X1$  X10X18 X1< 5X!<0C SSK/\ 8@kjM悀"3@-@X!\10 "@u 00!P` l0o&hl1X0dp1X1 lAT 4/@ @$/ 0S_悀q5r悀 0@-(@1S Q xT#8 T TSR  Q Q  nxSR Q a Q A!B a2!x!p@-(@ `0(P !03/sU PPmuPppB-(P 0`p(@01003/ YT TCUT pp0 pq@-P 0@(0S+ S S& 3S# S S- #SR`P15P1`00 #pdSRP1`001 `V10|1S01Q (#$ /j悀8@-@ PH PIi(P80|1b(00 000000008`wur8@-(P0@03/1SPP8B-p 0`(@t0SD Q<Tpp T #PDSRW0(03/X1 @【@   1yS\1yX1$ , X1%0 !X1R  8 X1< 5X!<0C SS`1$\ P0 pA$<<q1S xЍ󂀣悀悀D 0P/D D09Q9Q :900S8/mNA8@-@w<0\P%TPP <0 80 408N-㴑P0 pE %T@R T d+B" BZ D2 b> 0P H(5,ES0T@Db0@300 T000@005::05Sh0(5S0Z궠@ T6Z@z* JR ,5::@,Eu0S T`P Ahg ,5::@,EЍ냀Ⴠ@-0`` XvP( 0@ S,S ( fP  fP  fP  V$,`f@uP 0 R,R , :i`P| V, t)\,0,`T,`,,@f0ES 4,0$ 05!(0wu 0dSYp p'0S$p*d,(*EP X pPxQ+ g pk pPDC'+ gpi pP5 fpg pP'3  fpc( &p >@WpW-P p$83\, 1 0, C#( ,0 0=+ 0``* 0,P` *dP P P` ``0S00' S$ 0, 㒓#$ R0[ 82!  TLHHZ D2@mj 00[   `0SpGf ,0A#$, 11$`P&$ ,%0'() p&jd,8Trp  p@lW-g 0, C$(8) 0D  D 0D  D O2J @Ѝ;냀FUf_djBU̳xЍ荀P 3\}'X '",17킀@-L@P0SD  D c`00D  D 냀8@-PO@T 03 Df8@-P@p`P 0p@xDCOP T@T:'f0 3#80@-@P`pP `PhÐT,Ƞ Ƞ À0#S냀냀냀냀 0  /냀 (0R  0@ @ 0! !0x  x x  x / 0$0  0($0 0,0 /00#$0 00#,0 #( #$ /00/@-? 0@d 0@-P $@x0 0x0ex0`  0x0@e@-0@d0x000@000@000x0x000 000x0x000000x0uex0 00000x00 Ѝ0 //0% % 599<50% %08% 8% $599<$508% 8%0% % 599050% %0% % 599050% %/0% %00% %/08% 8%0 08% 8%/0% %00% %/0% %00% %/0/0/0% %0^   % %0^  % %0% %0% %0^   % %0^  % %0% %/(0 0$  ( p , #0 / P00   0/@-@@P   0 / 0 P//0/Rp@-P@@ e`0#E @@pG0/ @-`@$ "4//N-0@"0pS p 0 Q 0S ZP@@c TPz`@ 0P0b` c V0@ V0@D @PPP`@4" 04/Ѝt N-0`(@,p4P80w  0( T 9CR:)W W & TT 81 0000 bP000 pZ P"dp DcZ C" T#*0 SЍ\?vN-pR  c 0S2@ d@`" T`P`@ PS3p2`p2P h!"XPD!V  \P r!Qh!0S S S !0V @0P0 9TP@ |b0@D0!`@k!T0aS@ 4 Pp] \ ^ @ LD RX p#YY`  [ d0 0 h0 00 P  0H@0pdu!@Ѝ냀)L0V'bt샀냀9]/B- Mp `P PU G RPA0SDh H0^ 0U 1 U: U;X0H0\00]000 000@P*@U U U&0 9/@P 0 9/@Pt 0 9/@P P' 09/@ ЍP냀 N-R@M@0P0  c 00S:S #S  0v`v  `Pocq&X0H0\00]000 000&Pp pD0S "0SXPp  0rp[ 4/]0S[ , P `P T `Xe  (`0E3/!z 0^ 0aV [ ^R^ pi  006/`  0q`@Ѝ냀*d킀{p@- `@`PP$@ |`P  v`P0  o`P0 t h`P0 \ a`P0 HBP04 00:p$(f@H>PV੃zBQ0@-M|Rx@ 6`PJ  0`P1 R@@? = #`P@7  `P@0 l `P L1 RPP! @ 8 `P@   _P@  _P@  _P@ % @00 04@ 0 oP ($`PP0@DD>0S dmd!oЍ0T샀 (੃+X샀/@-.KPK evR@-ʸ) @b`6vpP 0 R :R ha aPPsP ( 0Vu ЍRF-MDG@ Papu@P 0 R :R )+ a``r@P  0 aY  a  up`0T @ @ 8 c,  ЍH{RB-`2 @{apuP 0 R :R  faPP rP P 0 V 0huP@ Ѝ$MOR@-@.`^PPU@P`HPXXx^PPh 0MT^PP@P/P@0S o0sS nSg,c_'c Y0nScPcJ$ 0 D`A0pWppV (`d7\430 6 ; A #?F \ ` i xn { \ @-((  `0 0 Ѝƒ0   / p@-CM` 00/P P@ 0/ P 0@P^@0X z0H0n 0 $bCލpU!tR z @-P @0 R / 8@- 0 @PT@D8 `0@S/0?S@/@0 R0S#?/@-@@DP 8@- H@P00#0P0Y00)0P0 8@ 8@- H@P00#0P0N00)0P0 8@ 0 , 00/ 0, 4 8  < / 04 , 8 <  / p@-@@, R @P5/0D R0,0p@0p@/ @- 0QpAH )00 00#0D0_0R^0H0H`L0`cV@@V~00@; V!00@6 N0V 0Cs0 0 00@- O]V@00@% P0V 0C)0-00@ Q0VD0#00 @ VN 0F @ S1 @ S @ @"00 00~0 0!0 pppLp`00 00Y00`,)0@ 0` @- 21N-(M`@P  T_PSV J_VP C_pP W P ]peP ]w Pp\@Pd L Dc@3@P0003 @@@0 0)0#0D0 #H RP P`{Kd Ga p @@t@ T;T {0p 0C s00Cs-.G p  Br & > p_0 @p#00p 2 Y ? R+ 0 0p $ D[0C00S S[HH H R B" % Y3p ? Pp P  @@S[ gB[D`Bd@P :]@Tl  ``u@@P W P ]P ]P p&(ЍF낀} tlR z L3 X v Rp@-`3`PP- 6^ @1^P U0U00U 00S: U 00S: 0S 0pN-RpḰ`@P$ @P ]`Z`  ]P} 0d& ZP@`Ѝ䩃R@-(@ ]/ RN-`V P]VP  ]VJ  ]V@  ]ppP$P 5WYI + 0 S 4 0:` V* R 0pP`T@dPe@10 @pЍ# t L u B-P0BSu#`P L]l0 @@E]Yp   =]Vp Vpp@P*R@- IUp`PO 8Q] @@]P P ]pW( V  0R 00j@"V  0R 00]@ 0R 00R@p@PV@ V L H D DW@<0 0; Ѝ 6 l t F-q` @P xPP:  \@@ؐU U -P P0-S | \0 0S U UV@S @PV 0eV 0@ Ѝ[ R @- R@- *`pP$ \\@ PPU\@ @ O\P LW00 W0000P@P* RB-pQ  @+\h0 ``$\ W I P,0~W  \P R A@-% 7@-P@ [0p -R [ Ѝ0N-0Mhr`$(, ( R,0V$08@0偽 ?60T#2T !0 0 0Yl*  P00 0q 00S Q@[  [ x![t10l1h10 X0;Q- <R818 01SQ!00S S!  SQ00S S    Q R |l`pVm0ЍP詃1[o  xRN-0M U @ğp@0 P 00!00000 0000020 0XP!@͕00Ӆ!0ͅY  Y  Y  [Y 0iS`6Y@pp@T-00$ 0P! $ 00P: 0Ÿ  0,P  5@t@@rSp@30S:0Y "0ⲢP \ @ 0R 0R ( y Q  R  pwpwSp@0SV:0 S: 2P  @ ypwp h WP.0S0S@ ?@0 S*:p R$  0P  @pwpZ $T y  W@PYp 00!0000000 000200Ѝ/{ fx@=F-p$M`P@P  Z2 ER3À ÀPÀÀ YPWZp2% h YH2 <82  Y2 Y2  OP 'PPPgQ1P .1P |%t0S hd0S XT1P @81P $1P 0S UQ pg P VPP00 P R 0@PR@T$ЍF낀L烀x郀<~@Ã<Ã胀b胀4Ã?낀xÃ胀胀킀%"R8@-P@ZVX PG 8P, 8 8/Ã@-0t 4 0/ЬB-a@Pp`W0=S @0S =PF-MP@@U0 P( U PPPp`0pVG@U# `Tp @UV  < P @ЍRB-@pP`PPP   P $  P`V-NN-0@0ppP `= VP  Pp3P  0S 00 Rg0\0PPUP UP UP [(UP 0SU0ŕPE ;X P K P P P |2P t 0 PR  R00ZP0S P0S P0SUPU U Y{pe[Ņ 0PR E R =0P R`ZUP LUUPP0p`@PT  WTpd @0S@pW06o`+8UPP W0,UPP Z3` P[0 t P UVP QV PTЍjЬ 낀킀?낀F낀LO낀烀} @-<0Q 0 0S ЍR @-@-`\pPFP @AP T @QPP@?N-ᨠ@p`(PP!P UP 1P``d PT P PW00RN-pPM@PXTP^@DTY H W00SPP H0:SSK:S` P 0SD H VH00S`;Tv0 H V 00Sp. H00S*T  HV R0 H R0 @P( * 6pP 0@`!  rOe0SJ TPTPTP D V00S D00S D V 00S D00SD V00Spv D00Sr 0@ " 0!"SR #@Z SP  0PHRP4 D0BSR  RP0  H cU0 0pPH00S d0 0 0 a PЍ@BDIOyxNz"UN-RhM  R RS UP UP#P\@ T`P 0S|9`0ShQ0S :SL Tpp  iP  HR( R00<$0-= 0+H@ ?RP  9RP H00 (0` 0 @lP `gP bP ]P PXP SP pNP F/o"V R U Z Y   GR @R< p 0S!Ѝ5!N!Y!R8@-@d` PP @PT o8e 85!N!Y!R@-@X`T] OP0T$0!  ! 5!N!Y!R@-@D@@= OP4 5!N!Y!R@-@X&T#  OP@@P@T -!5!N!Y!@-0P P S QS   BP|   LR\  L LoR  R\m!!!!R@-@ P]O @XO p SOTP`lP PPL   00 ! 025!N!Y!" Lo- P  ^<<,P P> R *b 000 S*t  > 0 0 0"0P 0 0 b 00 0;@0  0 2 |P0p >p OPp0p` V V V5 V =V  V 7V V( 20x01dT00P0S<&00C00P00S p 0P0S0 S0S p 0zP0 S! V0 0 01PPP0t00000000`P000 Ѝ@ Գ*t A[س0A0AA(k8@-A@P 0 S S S @ 0 SS1 TP 8*F-"M M@pT 0S = P:HLz=P`0S@ @0 R 'R T\R0# S;RT  T\R 0@0@i P Pxj0Z  0PU P P@0%T00S eP@D UYt@p,Pd@A<pHo0D0s;D傀****++(ko$_#+F-MM@pT 0S = P:f<P`0SZ @0 R 'R T\R0# S;RT  T\R 0@0@ P5 WP -0ZW( 0\ /? P*? @%? 0I1AI 0:1000$0,0(0(000$0,0DЍc -Xx0- 0 $  04|0 $0R |0R| @-@T @Dt;40 R    0S|Y/ d 0o/ d- ^X d@-@0`VRpW$ 0%4019 0.S P\0( 00WV 9`FSV9S  Ѝ ddS8@-ɀ@h \ P VP89PESU)0  8/ d|/F-J`pP1U@㙥) 1T@GPpN- P R  a:A `p !E? RK R 0R( R= R a0 !  GB: %&,0㓶"&&&0%%  J R p<P\0ZP* 0ᓶ n: R @p-0-T-{-@-g ph0M@1@4 @ 0K/  PP W0fppPt00t0l0`l`Ѝ@-$Mh@r  2  0d000Ѝ@-r`@ P P0pP P`TP0T U P 0P%TP Ѝ--@-d 0  0000 0Ѝ@-M0S AT#&1S 0r hq Č00 0}?00~0 |Ѝ-@-M0qh @!$d00 0 0_PlpЍ@-0r hqČ 0 0d00!0FЍ@-4@Mhs0q00 0 0d00!0/Ѝ@-4M@s0hq0 00 2 0d000Ѝ@-4M@s0hq0 00 2 0d000ЍF-M@ḣ`pPh0 104d   0PPUЍ@-rPq`  p@P00 0P0 00P0S0Sh 0QS0 Q00PP Ѝ蔼RS@-`M@002Qp 0PQ  0P0S 08049 0P`F 0?PQ:000 ^ߍ.0  r0/ d8@-x0` QlO8\ P@04I00S@`ʅ <98ă. dp@-N4P 0``:0C`: 7`:c$00pă dp@-@8P8`.700NT0 `*p@$d*ăB-P@p`<@dZ`Z`PUPdj` Pă d@-r h0Č )d   0Ѝ@-0qh ! $00  0 d00 0Ѝ@-0r hqČ  0 0d00#0Ѝ@-0r hqČ  0 0d00#0Ѝ@-h 0Č  d 0Ѝ@-0hqČ 0 d   0sЍs@-`@P9UP  9P9UP P9UP  "Ѝp4 @-0S$B d,5.N-M@PPw@ ;P 5P  7 0 4 0#406 6 0 !0S 00S 09\P)[5` bP+p? 㲠     R()R      O  ߍB-lMP p!| 0 @PhP  PQ| QhP Q @Q0 00h0pP PY P0P PdzPPTu  PP P)`7(p H`6 6 6Q  0Q  0Q  0!1 S"1S 1S J?0S+10SPߍV....-/B-0Pp@d:``:P0p 0S!S@P嘐 dzp.500N T0`:?P P00D`00,00ă de/m/*///F-@` PKPKp  1(9S > p   /P 0ᴐ pW  tK Y  Y  Y0000a( $Y IP  Ѝ/9 R  /p@- X`@P?50000T00X0 0S0003/X`p@-@M0h !$000 0}?0!0NP09 h0 104 ="  h014 =Ѝp@-(M`@ P400000h !$A P  }!0 h ! $- h ! $- (Ѝp@-P`` @p L4Tp 0pS000,3/P]d@T,0 P0l 0 /,N-PR Mp 1p`l p@6#0[0P 匑Q|Al0㓖& 0R0P`6 P 0@ TFV 1ɚ XT S4(   p `S 00 2/0PT0Yp Y' X  W 0 0P$0,0 0 }?00S 9S   009,0 U ,0U [0K ,0PU$0pW090Ѝp@-`@S00PU0 S S X00p 0S0SSpp1SpSp`0F-pM@P`B 0S Zp !"$ ! !RPW09,03/O 0S0SSG  ]2R02 00 0\00`0 0[0 0SZ09 0S!R!S S W Xd p4 `V  UЍ00@-0h !$0 0 0}?007ЍF-$MpP1@᧑|P\0 0 h  Ġ`- ``g0 0T0Sp$pY  }/ X 7P09 Y  P09  Pp}?0 0p'P T0RL0"0 BR0ST QS $ЍUSBS,B-PqW ps`&Go0S00Cs0S@4 v1pPp0 00S 0 :PS X100T1P100L1,0 0<GQ   0Q  %R pP 0S 0S 0S 0S 0As0Sf R %0S0%00h0 ,0$9pI[NlYO0"1NF-P@1$"p SS "S "S ,03/a?X00 0 0R0q 0$0T00 0S0003/P YY괒"0 S `q 0 00 A0 V00 0Q0Z0P  0 P 3 1  0X00p% 00T0 0S0003/P pW--< 02/h3? ` %00 S 0  G Ѝo LQQT,[1/m1I1悀N-@,k0TA`pl P[00 00H`VP`l@@弐`P"P 4㚒"P 0l ᚓ!s"0P000QTlP UP8cP}1pQ\S,118@-P8@6P@T 0.P8"8衆@-@0PЍ䔅B-@B04S 004 `p0 RP 0`S S404S Sp$4W0$4fV`Q0! 40 40l`aP 0TP 0PS;04044qU0P 80P  0P (4S $4P0#S !0nP(4S  , $ 44P R 0s0 $s0RЍ䔅옅혅B- ^ @ `^9 V 0^APNuPU ~x^P0pLALw`~ V``^ࠃࠓa`Lv`VVa`Lv`VWL^ 7L^$`S 0CP\R@F-0,APP#00T(4,T0T0CTT4 T$T8T4T&4S` p@ 4,PP u#pGW(q/(PC 404@T4S 4 RD0Dp00 0$0 4uP Ѝ䔅 &N-8`pP @,$RV$RiZ_ PP;$ R/ 0 $Q 4$R 4QR$ R\ QIR\ RR$R \\ B$8$ 8$R b$0AqRPu u$R (PC$ $_P ,$(PCz$ $U0 P`0$,$R  V`j Z.$ p j$$ xЍ䔅<0@-$$(ē0 \$$ $ 4Y Ѝ䔅111P@-@ t@40CS6420.,*(0,44/P@}.䔅P0/ሴ=2/@-\0\ 000S=D00 RP( P@ dR GyP0/Q 08$ #ґ 0 /₀$B-@pp`PU>e/W00>;  `T0BP0%p!R4Rr  %,R%I,\ETPL]A0 0quP# S0C40Cs0}$@-@@-MPp000@@`P 04008000 PL* V  5  I  ЍP@-@@ F-MP@0`008PPp0w40 0   n  r     f@ d  D  0  0b"    .Ѝ$P@- @@ r @-@/ 0 0 /, 0 0 /, 0 0 /,8@-PQ qqqq<d@<T@ P0Q<D@@zIw0`8@H8RR0むP P/ Q 0(/,C N-`dPNd0p`4@P @< N0GS$s$s$s,sTs4sM 0 0Ѝ萶D̶0@S0@-@LMP P0 02 P0 0Pc LЍ0@-HM @@R   HЍ PP0@-@LM NP0 R  R  R   PP   LЍ03@-     @B-P1 aʒ9# 0Sdxxyyyyyyyyyxxxxtyxxyy$y0yPyyDy`y@QP@c@P@AP @HP@@@P`@Q@IP@P` @qP`xp@cP`p  \  x B9) B@P,Ip@-@S`hM T&`*0  0T#0 0T"`  T&T0S( 0S$ `$3T&0 8 1!S*`0000d00000 $`20$`,000(0;040 Q`T&0   0  0CS00c000c00T#0 ``E&s{0T# 0S 0Q R RR  R 80@80@080T#0  0 )  0T#0  ) 0T#0  ) <0S TA <0S2AdAqP"000hЍp,p^むjむvむp@-@\P;)0T"`  T&0 000p,p@-P$ ` @   D .a@Tp@TB:M@-@01/0000/ 0 /8///1!| e 8C 7("" "0"@"P"`"p" ""$"4"D"T"d"t"""("8"H"X"h"x"9 !!d 3 D 3#   ( !/#dDDD#&&dff2Tv 0   /(0t! t!xx!||!!/0P8   8 /@-@o  t Ѝ0//@-@o  c Ѝ0//@- W0@-@o K Ѝ0@-AoP 9 Ѝ0P@- 60@-@o " Ѝ0@-@4@o   Ѝ88@-PP@ `  X0T $$ U 4 $0T $$ 88@-@P ,  T  @-@P,  T @-@P, ? T ? @-@P,  T  $0M0  !  Ѝ/81PSS /@-IPP PPhpx / / / / / /@-//(3悀P@-k" Ѝ(3炀P@- P P P " ЍK3炀/0M400090 0$     "  !  ,  (  * 040Ѝ/8/P@-X0@0000?00 "LЍ8(3'炀Pp@-P Mhb@ 0000200 u! Br 00 0 00 0! 0 Br 8 00  ]0001 S0Cs0( !0 Br 000 D  B000000 0 Br 60 0 Br :00 '! B000000!0 Br 60!0 Br :00  ! Br 000000"0 Br 800 # Ѝp8(3>炀|0@-@  0000100 100 000 000 Ѝ8P@-#y:0Q0!  Q' Q" Q*  ! Q @Q Q  .  * .  ( .  , & $ "  != Ѝ(3S炀8k3PM! P000 !  +  !4! / 4!8!  /  8!00000200 ,6&($<&Ѝ悀83肀3P@-P0@@D0 <00 00X&Ѝ83肀Ps@-P%0@ .`` 000 6 0   B000   B6 0~&mЍp83肀P@-@ 0 0000?0 0 0@ST0u 0000?0 0 &>Ѝ83肀P@-@ 0W 000000 0 0@SX0t@E 000000 0 &Ѝ83肀P@-P4M@d"%,,0(pu,,0pp",,04pu8,0pp",,00pu$,0pp" ,,000000080,0 ,,00000 0080,0 ,,00 0 00 0 08 0,0 ,,000000080,0  ,,0 00000,0 0@Sb,,0(pvu,s,0ppz,,04pfu8c,0ppj,,00pVu$S,0ppZ,,000K000F080,0 D,,000500 00080,0 .,,00 0 00 0 08 0,0 ,,00$0 $00$0$08$0,0$ ,,0 0(0(00(0,0( D'4Ѝ83邀P@-@\0"0@S @000 ;0Ѝ84P@-@|00@S\0   B000  B6 0'Ѝ83邀P@-h0@   B000  B6 00@S'bЍ836邀P@-0@0y 000000 0  @R\00g 000000 0  7/Ѝ8&4P邀P@-`M@PdpAQQor Q43#<0000?00=00 TpW T2#$0000?00<00 0pDoTSrp2 0000?00<00 TpW T{ 20000?00;00 gPh`AQQoob Q100 0 0? 0 03 00 T`V T4100 0 0? 0 04 00 0`DooTSb00000?00400 T`V Th00000?00500 '(NЍ83i邀P@-`@PBpAQQor Q <2#\00 =0TpW T 1#K00 <00pDoTSr 1800 <0TpW TRh1EPL`AQQoob Q (100 =0T`V T 000 <00`DooTSb 000 <0T`V T L000 ;0}( Ѝ83邀P@-`@PBpAQQor Q <2#00 ?0TpW T 1#00 ?00pDoTSr 100 ?0TpW TRh1EPL`AQQoob Q (1t00 ?0T`V T 0b00 ?00`DooTSb 0O00 ?0T`V T L0=00 ?0( Ѝ83邀P@-@L0ՍP 0000 90Ѝ8P@-@ʤ0t@  000000 0 P\0t@ 000000 0  )Ѝ83邀P@-x0 @R \00 0 P$0+ 1) Ѝ83邀0@S@- H0@000@I)Ѝ83邀0@S@-\0@0000000 ^)_Ѝ83邀0@S@- H0@w00 40u)DЍ83 ꂀ0@S@- L0@0[00 60)(Ѝ83#ꂀ@-p0@@S7P`0=V0 0& 800 0,0 4$0 ,0 0$ 40 $0 ) Ѝ83=ꂀ0@S@- L0@000 40)Ѝ83VꂀP@- 0Q0#"#l)hPP0Q 34 Q40), 3*8(3tꂀ3P@-0 $  0: 500PL0,0:500*j8J4ꂀR@-03 R Xx``PH xx!N:JX `1( 0\ ꔸԷܷ02468<8: {*4Q70S $,, 4PK$1r> 4% 000Ir@ 2\rB 2WrD 2RrF ,05rG $00r: 1C1r< >0Ds0 TS 0Ds0S@Dt@TrH p0rH 0rH B`rQ%)A,!p/%rQ)A,!0/rQ%) zQ%A,!0pp//rQ%) zQ/%A,!s#40/M0100 000 00Ѝ/@-@P  H  4 $   @8$0-s^7702:D$0-s^7702:D0/D0/D 00/D 0!$ /D@-@o@- l0 @ A B   (   @DDHD P8008/( P80 P0088/H0dP 80 8 R:RR @0A0 8/T0( (/0( (/2F-? @8  !;!7000S!.00T !%@|1 H(d140S6S :SP!LS 0@!@1( 8@Pp` ,0YS&S0p00`S&S0P@9p9`9@9 P@!R R  ӄ0R d0:RRA  @ (@ (@ ((HXr 50 Ѝ84T@-r@ 0r @@-r |r 0@~@-@r p@D@ % @@-r Zr 0s0\r{ 0@V@-r@H HrH 00@I@-z@/ ;T@z/ z/ 00s006@-r )?P00@0 P 00`0 P0000 P00_00//7@-@z>  PP 0z> 0s0 Ѝ08@-@P_uPUp@z> z> 0z> 8z@ 0zA 0zB 00dzC s0@P/t uPzr 0U@z> z> 0s0z> 8@0J @-1@rrJ 00s000000 0 00r r 00s04p@-P%Uri @@qri PEuP00qz/ eU1s0 rJ `P[0?cv` `rJ PP P0? `rO P0z/ K0rJ Fp@T0r@-@  00.z/ (@00XPp@- P@@PP@Pr r ?3s0r r 000 r r 00p@P@- P R R +Q QQR R UQ FQ 9QR R QQqQr @@r 2@s0824 N-d0 T7r p@`@P `P P ```I rrPsW!P0 װ  Pr 81s0 VP @VP VPPT00 TZG T [  @ T `V9 PN u@ TY @)%Q> e@ @r Ur 00Wr Kr 00Mr Ar 00CЍ`むB-@ `P00~r p!r W00s0!Nz> z?  0z> 0z? BX@-%%i0%%4\s@-]勿P P `PN)K&w qP  0 @x6@0S0S 0D 0 &0#Ѝp45\$5 5H5R5\555@- |C|( Sh3PRP `\3%R`XT  T T  T    (F! "" 0 P 40PP5% 0 2 pP2 pe `l$0   P(``g<, ,D @<   0(*$ &($I",0`04 Q$8( 0 S,N#.Yhi_/E0 c 0@ST0ā/A` 0 S( #.6l m0 S 0@S 0 0 S( A Tp P` LLM  40T  T T  T (5h5d`ԭ5%N- Mp<000@^3 ^ ^X ^L7^ ^ ^E@\\D uOT P P` ^PQtl ^  tA\ YAPU `fp@t@ @Tt  P^ `x_ &R``dP ,0 yz.B)$@ T d(| 4`2 ^ß&y_` Č`,$@(@0z_|O @4Y$(|  ^U\ \ U\ \NPJ @à @PD @PU `dŸppp\`@p ``_@P AT a` PPbq@DP>]ⰰP^Eq@EpAQapP\ ʌ@p@T@@t@@ppG@@H<x@<Q@Čx0t?P"x_Q0S0\#b0000hcl<icm<000 ^ ЍhL˂ܵԬԭ踅h`Ʌ蹅B-0l!hPdAt> 00p>l>h>d>`>\x> P \0  P a۟t?>0A@F0A0AX>B  pP  R 0S0   R< S|0t 0 S`0  T  0 S00LHD`Ʌhܵ蹅ԭ Ņ ӅX酀8@-P|0|@0p<Ph0PS 0S   0P4.U,()8&8dh 66Z6F6PN-0 P P1 @ \ 1Q$ @>(@4\ P|/@<> @04\0P@  ^#P `p〡   Q ` pV̌  0Ѝh ŅX酀N- Mp@a0100!2 0 Tlt^0PUg*180 0W34O3 x1p加0哥%P UFp. 0 RA*083,10230!  o.`N^,:#LĠ2 ~ |0@p ^ ^ \ \0\0P PP | #3P00@p Ѝh`ɅX酀 υ Ӆ ׅ(0 P    0d.`/h`ɅF- B bd>S`.0Cd>rpWs0 `.d>`.0Cd>00`>sQġXT1 >͌ Wd>S`.0Cd>rP0 `.d>`.0Cd>00`>pYl^  .B B Wlx/ |lT%"Pl.h^) d~W ` ed.qpWr wp``pgywpW pGy p~d>0gwd>P#0wp`wpEW h~?pU'uPPeh^`ɅLhB-@PXElP`ph>8XNE@80bPl.xRh>S 01@?TS0R h>@?T!80`Ʌh<"N-\>4BSd>`>L>H>D>t?RSc Sx0p8 a Wdhl뼡P  N e1 8L. 8 L.00 Pp$0P(h Uim<pPH-018H. 8 H. 00 PlP|?P  08D8D00 PP U#im ^눐 pP hlRPT08L. L.D08    P<0,SЍ`ɅhX酀 n6}66H0 D@- sSLT00  S0ۅ N-0`P0@0 0Š0 00 100 000000p55bv&萟0 lu%ph0Ȑt$~.Ttp2"1!np`d0 b an0 pgC4LĠN 0cLĠnC4GtLĠ  kA0LĠB$  p8@ N-0 `P0@0`0 Ġ0p 01 pGs|1(. (.@ (.` (. (. (. (. (>05t z⚖&L嚕%ha 8Q⚔$㚞. lpT qAPn◑!b~㗒"p`d@ a! b`e  pgAJ`GwFd( @jADGA(  fALǠ (@  kAB'!1(`(& (& (& (60X酀88@-P@ @ T@@l T8RB-PM R R@0@,0004@p0 `  R 0 S 0  R 0 S܍ĥPN- P P0@P p0$P(p0@>0 |_ p@<>0|4@ @pP 0S`V  0`00Ѝh X酀N-XQXAp`$( |@><> 1/ 0/ 8/ Pp,/4Y`V0xQ [0Q\n 0\>L p>1 p>S:0p><0 t>1t>p>St.0R*`hX酀`Ʌ6Q /6Q/ \ 7 72:/\ 7 72:/p@- `P @0^   ^@ 0 Sp0@-M@    0 S 0$ST 00101 0RA \ 0P@DPH@0S,<ߍ0͂ ΂p@-M@`P, a  t,] T VUPLP0 $( 0 S ,k܍p΂ςN-MMPo+@p `  ` 0 pp #.R 4L:   0Q0 0S R_M  R/] &j  'z F/R &F/Q R.w&)0 F_a R \  ^ p Rp ^  0/P` PU- P `pW"  Y  j i j i j ip  S _Eυ  P `Pύ`P T 0S|0,00ލЍR ` pPpv`zvahj`aЂN-MMP+BO) ` H% `` H 0 `` #. F/1 FF/F, asF\0F @B Pa@P \ p Bp @ @@ \ @@@A 0 @ ^-  @P U" `pV``p`g`p`fp````p`g`p`fp````p`g`p`f`P  S /ς,   P @ύ @P @D 0S~T,00ލЍ R P `@`uPjfQXZPQN-CM0Mp+``  X\  X 3C-@0 8P@ @M  I +OE #. A VLf!] 0 @ S ̐Y&  V 0 =p J ,&   @   p 6 ,    - ,    , F/   F/Q  G2C-0 @ 0X ps!p  pI  \* Z C0 BII i W Sύ -΍ R O~  0@SF0X pR O~  D0 8p<S8pp W0 -06.O+ =Cݍ0Ѝ ЂN->MMp +a ` X@[ 8P 'U  @@O  K +G #.VC  V? V/,:   6 ,VO0 F/VL FF/ F Vz.'uX0 r pJ  \p* W > 0 jppP SJ Z R ύppq 0@SFO0X @R ύq tq D0 8p<S8p@ T08 -0$6.+ =>ݍЍ@-@@30/8녀00 0   /8녀<0@-@ '' 0}-  0 @@-ų)0! "0 /0/@-P `@@V` 0`|甾p ` P @0H煾v4A @a X6@6<녀F-p A1 P``e`f 03/P ]D0 0Cs0S@`@`K0 0f iU0˰00%30  0@ U%S  @ 00S %3d!PЍX<녀8tl8@- M@A  0 $ @` @P`@do4 Z  RJL0P P^`@N @  TN~D^? YH ` `@~$^ `@(@PŎ``P(PPǾ(P` @`D@L`P@2@h 0PEa00'h0S 0>h 00800S>l0pL0 0T0T00/>0l0P470h000d`0h Rl*TLN0SW 0pGePQU*W pGeP6cPc0 h0QU*W pGePR6cPc, 0&a6PE"QU*W pGeP6ca W pGePU:6c c c0 P R5000Q:h h 70S l/΄S>l0pL0 0T0T0 0` P5F`l08P00X0X0 0d P450000S 3/1WZ  p 8`

hւ&>?>Y>u>C=-==>>40S&,&4,<0,04 S P000 0P` 000S 0S UW 0pGeP0V0P`0000 p(08`S>6P:O @-0?#80 #0B:P:O0S A Cr R 00@/p@-D@\ `^ P`0 p@/p<셀 0S /S\S`//p@-@<`S S SFU5`c <P<Pef<U <0 Q5 #P'\<S S Sp`p0`V#10 V V0Pp#p0#p ppQ@-@> l`M<p1& T:|P TPU D qP$C  #ߍCB-p@ 000P0 ߐ0 `.00 P`0 0S  S00B.p@-MP`@ /P) @ 1 S@P$P 0000P0 SX @ P 0 ( P00܍pCDD0@- ^# 0 S0@@@T 0 S0 ^ 0SF-p>0`(P @4  T *\  RL @|P< S?2Q }6 @D P0@ 0  0S  S00  F>0` 4PP `B @0RS4 V: `Ft @D ЍD셀셀N-(aP0A0 0M00 pPP0YZ  #,0  P吠000 00   8Pl @P 00 6H P R4 P @@K<셀놀*DUDXD\DN-WMM@>P 0( |@+P D* R09@: @: R8 3@ @1)03A#8咓"040: #2*0:0,:0/S\SPP o7W0ST 0@gP  P 0` /S\S   g000\P , RX'PH  R x 0 e 0@b 0 &0 0T+ 060SN   :0S Td 0K0T 0 #0r Sr 0R+ T 06 W 0S / &W0S   0 #P P 0S 0  <vy$0 0$0 $3PQ*000S 0S  R 0 #0r Sr ,0R 0Pv0P  U PQ P  0 00 /S\S T S 0T00S@01D* R/, qpxp #3P 4'PY$l@  0 ,<#0S 0 0Sm  Q4  ^/ 0 0/ UU2W0SO  |  0 0FFQPp @ Pp<6*D: S?2P:0#T@@Tp 05 `X ,`D:sR S㺑(At@PHQV@` U*  P0@ S%P8*D: S2 0P1*PPg  0P 50`e  0P(   0tP @`e PǟD: S2 0P*P 00WݍЍt 솀bDtDD쇀XDD@-pMA0S, 土000CSdztz|zzzzzlz ~0zQ0 e@P tp@  PX0X& @0+@bpЍ<셀DDDDDDDDDDE놀E0 `p@-@P`E 0p@S?EB-`L@pPU h@ HP 0B/QAY I>QA.Qڤ0 m30 p@0S  0 P 00Q0w00S    EkSD 000S S < " $0S @0 @20$ R  R  R R,  , 0 p20$@ `" 0S @0(@H20 R  R  R R,  , 0 20 @p's0l 23 0l00Y0V, VS!W a@` Y i T0* I@L1W43@00A773@00A60 BR񏐓  2@00A0bD`} 0@A02@00A< xbD`j 0@A0 0d b"4S S SP@`^VR`# VP `!VQ`# VP `!P RVQ`# VP `!+P 3R?VQ`#P V/P `!@96 00)00<p  0 000  00000<1R 0  ͅ0L00S400ͅ0͕00ͅ0ͅ0V`! V `!``0(P @`P@`P V `Z  ]iID0P0  0 ЍôWVUUxU\U@U$UUTTTTT8Tb$F$$#DSR/B-dBRbp0`0p0P0d<08P0p0K0p04 T0&4T0 PPU |p0K 0p0vp0q0p0Ap@ 1 1.p10011A- 1,p00000`1 PP0P100P0S0 ,PP峦0 P P(P /*@ 4 (&D ,  A!B0 !0 S 0 PE0(  HP =A @T @D\PP@傦L 00 0#P $.x',O$@-0S c/N0S/0 00C0/9PN-PM`@P Ppg P%P P`  p R 00004P$  (  ,  dP~ 0PX "*PF #P,pP )jP !nP ClP0Q%P '-P' .PJ +P!DP 9P2bPA XP) hP iPF uP sP qP yP< zP xP gS^@k*$@S0  .0@0N ZS $00pP0  c0P z,0 0000P4 PkK 0P 5WE 0S 0C3 PPj<,# 0 PP 0 SP$ >P pP@[p[K 0#0%0Y0 e0P RP P R   .+0P\ @Q QR P R P P?op 2@,0p@$WpSj 0S $ Z j0"Y00S 0[ P W  PY^ p0{pW P( P p@ A\@ @p(0S Q 0SRp Qp@*p@ 0S p@\@ @p(YQ0S p pRwp @T@  wp@ /Ppg  l  00 CPY  <2 Aq  P<0 0c,W Y p Z  Z  Y )00YQ b$$Y  b$ c0S  R    B/IP b R -PW Z0PZ0xP pW0pG[ p gpG0 PP 0S P U PEY PP P W* PЍhJꂀ< -@-   { 0S0  ЍЍ/@-  l0S0   Ѝ@-\c0?? @-ݓ|J/ Q/t:Pkl ?o/o0B0s0 P @ P @ P @ P @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @  P  @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ P @ ///o b0/PQ @-@A/Q  aB Qp 00`BSoq /oo @ r S?C S?C S>C S>C S=C  S=C S< "pr(n"p28,XL" pw>r "" pw|r& "" pw|r& ""ph @ L ""ph @ L ""ph @ L""p $|x ":pe)8,$X `q,@@'D "("P e8,( " q@?"" 8 ~"" 9 ~"" : ~"" q@ @0"" 8@ 0"" 9@ 0"" :@ 0""q,@'":P e)8,$ "` e)8,$~!" P e)8,$"" e)8,$#$""0*jh $@ @ %&""0* q'@ @(0'""  `>8W ("":'P e8,()"":'(*+""'`,@@'D ,-""'`q@?E .""9.e8,XL/""9.r(nL01"".Z z$>< 23"".Z w>945""0* N`q,@@'D 67""0* N`q@?E 89""0*]Z z*>< :;""0*]Z w>9<""N "" `?"" 8!-H*l$@"" j  #`!0 A""N q@( B""N LH@ C""4!@8 D""q XHE"" t XX(F""3 Xx@8%G""VL q XPH"":!w X@ I""dp@&(#J""L_0&#K""O  `L""$4!`(0'`$0M""0*L@#` @N""H?pp1@0.0@O""pp  P0P""c@@Q""'%@PR""-$!)`&PS""0*p'p$8`T"":4!2/@U""0*r*h)p&0V""4N*)&W""=6!0/@X""f!rpPp@Y""t'k8px P0Z""/nHAx$x X[""<?hK.xh\""F0!xQ4x0h]""Ddp1@.0@^""IXp1@.0@_""OLp1@.0@`""Y4!p1@.0@a""Op r1@.Hb""eL 8H@E``c""AUp @.@p+``d""pL @k@ph`e""(<k p  P0f""}Kd *$Pg""_E0 (4.Xh""m-!@ 0;5`i""h[p( (;8Xj""tLP @;8`k""tLP @;8`10b`     !(0)" #*1892+$%,3:;4-&'.5<=6/7>????????????????? * )+ (,5  '-46!&.37<"%/28;=#$019:>? (3= :<7 (9E83WP>%8DmgM#7@Qhq\1@NWgyxeH\_bpdgc/ccccBcccc8ccccc/Bcccccccccccccccccccccccccccccccccccccc (3= :<7 (9E83WP>%8DmgM#7@Qhq\1@NWgyxeH\_bpdgc/ccccBcccc8ccccc/Bcccccccccccccccccccccccccccccccccccccc  }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyzw!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-0123456789ABCDEF0123456789abcdef<<== = = #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @     >>t >>>> ??t !@Q<<== = *K @ @@!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> V@ @@8888888@X p@pp@@@@5,~hV!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>U-Boot 2010.06 (Dec 29 2015 - 13:49:24)tsize0hifmc100_spi_flash_lockhifmc100_dma_transferhifmc100_dma_readhifmc100_dma_writehifmc100_reg_erasehifmc100_reg_erase_one_blockhifmc100_read_idshifmc100_host_inithifmc100_spi_nor_inithifmc100_get_spi_lock_infohifmc100_set_BP_levelhifmc100_spi_lockusb_stor_get_infoVou_GetAbsAddrVou_GetChnAbsAddrVou_GetIntfAbsAddrHAL_DISP_SetIntfEnableHAL_DISP_SetIntfSyncHAL_DISP_SetIntfMuxSelHAL_DISP_CvbsDacEnHAL_DISP_SetCvbsGcHAL_DISP_SetVtThdModeHAL_DISP_SetVtThdHAL_DISP_SetDateCoeffHAL_VIDEO_SetLayerUpModeHAL_VIDEO_SetIfirModeHAL_VIDEO_SetIfirCoefHAL_VIDEO_SetLayerDispRectHAL_VIDEO_SetLayerVideoRectHAL_VIDEO_SetMultiAreaLAddrHAL_VIDEO_SetMultiAreaCAddrHAL_VIDEO_SetMultiAreaEnableHAL_VIDEO_SetMultiAreaResoHAL_VIDEO_SetMultiAreaRectHAL_LAYER_EnableLayerHAL_LAYER_SetLayerDataFmtHAL_LAYER_SetCscCoefHAL_LAYER_SetLayerInRectHAL_LAYER_SetLayerOutRectHAL_LAYER_SetLayerGalphaHAL_LAYER_SetZmeEnableHAL_LAYER_SetZmeFirEnableHAL_LAYER_SetZmeMscEnableHAL_LAYER_SetVerRatioHAL_LAYER_SetRegUpHAL_GRAPHIC_SetGfxAddrHAL_GRAPHIC_SetGfxStrideHAL_GRAPHIC_SetGfxExtHAL_GRAPHIC_SetGfxPreMultHAL_GRAPHIC_SetGfxPalphaHAL_GRAPHIC_SetGfxPalphaRangeHAL_CBM_SetCbmAttrHAL_CBM_SetCbmBkgHAL_CBM_SetCbmMixerPrio 1QHISILICON LOGO MAGICEPTGMK0123456789abcdefghijklmnopqrstuvwxyz %s baudrate### ERROR ### Please RESET the board ### ipaddrloadaddrbootfileResetting CPU ... offpc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32%pMeth%daddrethaddrnetretryyesnoonce## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to %pI4 %d.%d.%d.%dnonegatewayipnetmaskserveripnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: `ethaddr' not set Abort Bytes transferred = %ld (%lx hex) %lXfilesizefileaddrautoloadRARP broadcast %d Retry count exceeded; starting again [ Connected ] [%2lu.%03lu MB]%s [BlockCounter Reset] octet%lublksize%c%d%cFile too largeFile has bad magic %lu.%03lu MB upload ok. blksizetsize TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Not retrying... T tftpblocksizetftptimeoutTFTP timeout (%ld ms) too low, set minimum = 1000 ms %02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' TFTP to server TFTP from server ; our IP address is ; sending through gateway %pI4Upload Filename '%s'.Download Filename '%s'. Size is 0x%x Bytes = Upload from address: 0x%lx, %lu.%03lu MB to be send ... Uploading: *Download to address: 0x%lx Downloading: **** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathNIS Domain NameBOOTP broadcast %d SPI Nor total size: %uMB Get spi lock information all blocks are locked. Spi is locked. lock address[0 => %#x] all blocks are unlocked. lock level: %d unlock all block. %s ERROR: Invalid optin argument!%s(%d): Error: Wait cmd cpu finish timeout! %s(%d): Error: SPI nor wait ready timeout, status[%#x] %s(%d): Error: Enter 4-byte failed! [%#x] %s(%d): Error: %s 4bytes failed! bank: %#x %s(%d): Error: %s Quad failed, reg: %#x %s(%d): Error: %s Quad failed! reg: %#x SPI Nor(cs %d) ID: %#x %#x %#xBlock:%sB Chip:%sB BUG! ID len out of range. BUG: failure at %s:%d/%s()! hifmc_spi_nor_ids.cBUG!DisableEnableat25fs010at25fs040at25df041aat25df641at26f004at26df081aat26df161aat26df321mx25l4005aMX25L8006EMX25L1606Emx25l3205dMX25L6406EMX25L128XXMX25L(256/257)35(E/F)mx25l1655dmx25l12855es25sl004as25sl008as25sl016aS25FL064Ps25sl064aS25FL032PS25FL032AS25FL128P-0S25FL128P-1S25FL129P0S25FL129P1S25FL256Ssst25vf040bsst25vf080bsst25vf016bsst25vf032bsst25wf512sst25wf010sst25wf020sst25wf040m25p05m25p10m25p20m25p40m25p80m25p16M25P32m25p64M25P128m45pe10m45pe80m45pe16m25pe80m25pe16N25Q032M25PX16M25PX32m25px64w25x10w25x20w25x40w25x80w25x16w25x32w25x64W25Q80BVW25Q16(B/C)V/S25FL016KW25Q32BVW25Q64FVW25Q128(B/F)VW25Q256FVEN25F80EN25F16EN25Q32BEN25Q64EN25Q128F25L64QAGD25Q128GD25Q64GD25Q32%s(%d): Error: Wait dma int finish timeout! %s(%d): read area out of range[%#x]. %s(%d): read length is 0. Warning: Hifmc IP is busy, Please try again. %s(%d): Error: Dma read wait ready fail! %s(%d): BUG: read memory out of range. hifmc100.c%s(%d): write data out of range. %s(%d): write length is 0. %s(%d): ERROR: The DMA write area was locked %s(%d): BUG: write memory out of range. %s(%d): Error: Erase area out of range of mtd. %s(%d): Error: Erase start address is not alignment. %s(%d): Error: Erase length is not alignment. %s(%d): ERROR: The erase area was locked %s(%d): BUG: Error: Erase memory out of range. %s(%d): Error: Erase wait ready fail! reg:%#x %s(%d): Error: Flash type isn't SPI Nor. reg: %#x %s(%d): Error: SPI Nor host init failed, result: %d %s(%d): Error:The ID: %#x isn't in the BP table, %s(%d): Current device can't not protect hi_fmc%s(%d): Error: Current lock level: %d, but set value: %d got packet! send packet! FULLHALF100M1000M10Mgmac_debugphy_link_timesmdio_intfrmiirgmiiInvalid phy_intf(mii, rmii, or rgmii).Set ETH%d default to mii. phy_addrDectected gmac%d phyaddr set to 0, is it right? Dectected gmac%d phyaddr set to val(%lu) >= 32.This may not correct, use default phyaddr=%u phy_link_times=%d ETH%d: port_mode=%s, mii_name=%s, phy_addr=%d mdio0init eth%d hw desc depth fail! alloc rx fq error! alloc rx bq error! alloc tx bq error! alloc tx rq error! ETH%d: PHY(phyaddr=%d, %s) not link! wired, phy speed! Invalid speed(%d) & interface(%d) mode. Please assign which mode our eth will correctly work at. It may support 10M/100M MII, 10M/100M RMII, 10M/100M/1000M RGMII interface. eg. if your board have two NICs, connecting each phy using mii and rgmii interface, you can use the module param 'port_mode=mii,rgmii' to tell the driver. higmac.cETH%d: PHY(phyaddr=%d, %s) link UP: DUPLEX=%s : SPEED=%s %02X:%02X:%02X:%02X:%02X:%02XMAC: %c%02Xhigmac init fail! init eth%d hw desc queue fail! ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPUgostart application at address 'addr'## Transferring control to RTEMS (at address %08lx) ... bootargs## Transferring control to NetBSD stage-2 loader (at address %08lx) ... kernel image will overwrite uboot! kernel boot fail! XIP %s ... Loading %s ... OK Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Unsupported Architecture 0x%x Trying to execute a command out of order cmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartERROR: booting os '%s' (%d) is not supported bootmboot application image from memoryloadoscmdlinebdtpreplogCommand [ddr %s] is unsupport. warningfatalCommand [ddr log %s] is unsupport. Set DDR training log level [%s] suc. trainingtrhwmprwlWL not support run repeatedly. %sAlready done once, can not do again. gatedataeyevrefacDDR training finished. DDR training area: 0x%08X - 0x%08X ddr training functionload jpeg err. decode jpeg! decjpgjpgd - decode jpeg picture. usage: fatinfo ** Invalid boot device ** ** Invalid boot device, use `dev[:part]' ** ** Unable to use %s %d:%d for fatinfo ** usage: fatload [bytes] ** Unable to use %s %d:%d for fatload ** ** Unable to read "%s" from %s %d:%d ** %ld bytes read usage: fatls [directory] ** Unable to use %s %d:%d for fatls ** /No Fat FS detected fatinfoprint information about filesystemfatlslist files in a directory (default /)fatloadload binary file from a dos filesystembootmodeBoot from unknown device, please check your hardware config. nand spi emmc ddr version: %lx.%lx.%lx spino find nandChip:%sB*%d Page:%sB OOB:%sB ECC:%s ID:0x%02X Name:"%s" None1bit/512Byte4bits/512Byte8bits/512Byte24bits/1K40bits/1Kunknowngetinfoprint hardware informationalias for 'help'helpprint command description/usage## Total Size = 0x%08x = %d Bytes %X## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)loadbload binary file over serial line (kermit mode)Base Address: 0x%08lx Tested %d iteration(s) with %lu errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX bytehalfwordword at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) Total of %ld %s%s were the same %08lx: %08x %04x %02x ? Zero length ??? CRC32 for %08lx ... %08lx ==> %08lx mtestsimple RAM read/write testloopinfinite loop on address rangebaseprint or set address offsetcrc32checksum calculationcmpmemory comparecpmemory copymwmemory write (fill)nmmemory modify (constant address)mmmemory modify (auto-incrementing address)memory display1000???100fullhalfIEEE 802.3IEEE 802.9 ISLAN-16T%u. (%04hx) -- %s -- (%04hx:%04hx) %u.%2u,%2u = b%u%u speed selection = %s Mbps%2u = %5u duplex = %s%2u-%2u = %5u selector = %s%2u-%2u = %u selector = %s%2u %2u-%2u = %5u %sFDXHDXPHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x duThe MII dump command only formats the standard MII registers, 0-5. MII utility commandsnext page ableacknowledgeremote fault(reserved)asymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablexxx to doreservedasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities registerhostnamerootpathdnsipdomainAutomatic boot of image at addr 0x%08lX ... ping failed; host %s is not alive host %s is alive pingsend ICMP ECHO_REQUEST to network hostrarpbootboot image via network using RARP/TFTP protocoltftptftp - download or upload image via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocolSaving Environment to %s... Environment size: %d/%ld bytes ## Error: "%s" not defined ## Error: illegal character '=' in variable name "%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Error: environment overflow, "%s" deleted setenvset environment variablesprintenvprint environment variablessaveenvsave environment variables to persistent storageprobeFailed to initialize SPI flash at %u:%u %u KiB %s at %u:%u is now current device Usage: sf probe [bus:]cs [hz] [mode] No SPI flash selected. Please run `sf probe' readwriteERROR: read/write area is out of range! Failed to map physical memory Writing at 0x%lx -- %3d%% complete.SPI flash %s failed Usage: sf %s addr offset len eraseERROR: erase area is out of range! ERROR: erase start address is not block aligned! ERROR: erase length is not block aligned! Erasing at 0x%lx -- %3d%% complete.Usage: sf erase offset len lockall sf lock level/all Usage: all: level(%d), lock all blocks. level(0): unlock all blocks. set spi nor chip block protection level(0 - %d). As usual: lock_len = chipsize >> (%d - level) sfSPI flash sub-systembootdevice ** No boot device ** ** Device %d not available storage device not initialized. Use usb scan U-BootRawerror reading partinfo...try to boot raw PPCBoot ** Invalid partition type "%.32s" (expect "U-Boot") Loading from USB device %d, partition %d: Name: %.32s Type: %.32s ** Bad Header Checksum ** ** Unknown image type ** Read error on %d:%d See InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: Boot KeyboardMouseMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlyString: "%s"%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d Self Powered Bus Powered Remote Wakeup Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - InOut - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dms12 Mb/s+- %s (%s, %dmA) %s %s %s %s OKERROR(Re)start USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. tree Device Tree: infconfig for device %d *** NO Device avaiable *** storpart no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s USB write: device %d block # %ld, count %ld ... %ld blocks write: %s dev USB device %d: unknown device Device %d: ... is now current device 1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceusbUSB sub-systemprint monitor versionInsufficient parameter! Usage: %s Invalid parameter! Hd%d only supports HDMI and VGA intftype, intf %d is illegal! Sd%d only supports CVBS intftype, intf %d is illegal! Unknow dev(%d)! Vo%d's intfsync %d illegal! Unsupport parameter! setvobgsetvobg - set vo backgroud color. - setvobg [dev color]stopvlstopvl - close video layer. - stopvl [layer]startvlstartvl - open video layer. - startvl [layer addr stride x y w h] stopgxstopgx - close graphics layer. - stopgx [layer]startgxstartgx - open graphics layer. - startgx [layer addr stride x y w h] stopvostopvo - close interface of vo device. - stopvo [dev]startvostartvo - open interface of vo device. - startvo [dev type sync]%s - %s %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands hisilicon # In: No input devices available! Out: No output devices available! Err: No error devices available! [EOT](ERROR) [EOT](OK) start download process. *** Warning - bad CRC, using default environment SPI FlashEnvironment SPI flash not initialized Warning: Erase size 0x%08x smaller than one erase block 0x%08x Erasing 0x%08x instead Erasing SPI flash, offset 0x%08x size %s ...done Writing to SPI flash, offset 0x%08x size %s ...bootm_lowbootm_size%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... uncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedInvalid ImageFilesystem ImagefirmwareFirmwarekernelKernel ImagemultiMulti-File ImageramdiskRAMDisk ImagescriptScriptstandaloneStandalone Programflat_dtFlat Device TreekwbimageKirkwood Boot ImageimximageFreescale i.MX Boot ImageInvalid OSlinuxLinuxnetbsdNetBSDrtemsRTEMSu-bootInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32%.*s** Too many args (max. %d) ** ## Command too long! Unknown command '%s' - try 'help' verbootdelaybootcmdHit any key to stop autoboot: %2d  0%2d setenv slave_cmd bootm %p %p %pmiiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' No such device: %s NULL device name! MII devices: '%s' Current device: '%s' PHY reset timed out PHY extended status read failed, assuming no 1000BASE-X PHY 1000BT statusPHY speedPHY AN speed read failed, assuming 10BASE-T 1000BASE-X PHY AN duplexPHY duplex read failed, assuming half duplex PHY_BMSR read failed, assuming no link serial ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dERROR, too many USB Devices, max=%d ERROR: USB_MAX_HUB (%d) reached USB device not responding, giving up (status=%lX) USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) failed to set default configuration len %d, status %lX USB: scanning bus for devices... No USB Device found %d USB Device(s) found Error, couldn't init Lowlevel part cannot reset port %i!? Device NOT ready Request Sense returned %02X %02X %02X No storage devices, perhaps not 'usb start'ed..? Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. %s->%d,blksz:%lu error in inquiry READ_CAP ERROR scanning bus for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found CRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file HDMI has been Connected. HDMI has been Disconnected. Interface Type %d err! Error channel id found in %s: L%d Error intf id found in %s: L%d Error! DP_DISP_SetIntfMuxSel Wrong Select Error,VDP_DISP_SetIntfEnable Select Wrong CHANNEL ID Error layer id found in %s: L%d Error area num found in %s: L%d Error, Wrong layer ID! Error layer id %d found in %s: L%d Error mix id found in %s: L%d Error priority id found in %s: L%d Error, u8MixerId %d Vou_SetCbmMixerPrio() Set a wrong CBMMIX xtal mode cant't test hpm! mmu_enable jpeg decoding ... vobufInvalid vobuf address! Invalid VOU buffer address 0x%08lX jpeg_sizejpeg_addr<> addr:%#x,size:%ld,logoaddr:%#lx,:%2x,%2x you should set jpeg picture's address! PicType: %x ,Output Addr, Y: %p,UV: %p Decoded...%x InitTag error <> decode success!!!! JPEG Decode ERROR. funcret1 = %x funcret2 = %x funcret3 = %x Image %s bad total SIZE Image %s bad data checksum flash erase %d ... SPI flash sector erase failed flash write %d ... SPI flash write failed, return %d Image %s Bad Data Checksum After COPY update_ubootupdate_from_usb_forceSet alreadyUpdateFromUsb:%d Clear update_from_usb_force! updateforcekraauversion%dSet update_from_usb_force 1! Failed to initialize SPI flash current spi flash size = %x startvo %d %d %d startvl %d 0x%x %d %d %d %d %d setvobg %d %d current logo file len 0x%x 0x%x[ERROR]vga out type %d current used param offset 11111111111111111 current used param offset 222222222222222 current used default param offset 11111111111111111 avsave read flash error avsave erase first flash error avsave write first flash error change flash env flash param is ok board time:%lx usb time:%lx %lxImage %s bad header SIZE Image %s bad MAGIC or ARCH Image %s bad header checksum Image %s wrong type Image %s is bigger than FLASH Set update force! Image %s is too old usb_stor_scan number = %d firmware_ndkernel_stkernel_ndrootfs_strootfs_ndUpdate image %s, reset now! no check usb update device firmware_stchgbtpacurrent no check boot param current do_check_flash_boot_param nosmp dva000000current prod net 100m current prod net 1000m current hi3521a version 201512291350 init gpio led setting cur dev is poe, close net led [info]Uboot can not find anythiny to update ! u2boot21ak2ern21ar2ootfs21a%llu Bytes%s.%ld %ciB%s1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header (null)%u%uK%uM%uG%uTinvalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionNot enough space. Free[%d] Need[%d]WDQS Byte%dWDQ Phase Byte%dWDQ BDL DQ%d-DQ%dWDM Byte%dWrite DQ/DQS OE Byte%dRDQS Byte%dRDQ BDL DQ%d-DQ%dGate Byte%dCSCLKHost Vref [PHY%d]: Write window of prebit-deskew: -------------------------------------------------------- %-4sDQ%-3d %-10s %-6s%-4s%-4s RANGEDQPHWIN%-4d%-3s 0x%08x 0x%-4x%-4d%-4d Sum WIN: %d. Avg WIN: %d Min WIN: %d. DQ Index: Max WIN: %d. DQ Index: Read window of prebit-deskew: DQS [PHY0]: [PHY1]: [0x%08x = 0x%08x] %-32sDDR training is unsupport. %s entry[0x%08X] size[%d]byte cfg[0x%08X = 0x%08X] DDR training cmdPlease config DDR training item. Bypass bit: [0]PHY0 : 0x1 [1]PHY1 : 0x2 [4]Write Leveling : 0x10 [8]Gate : 0x100 [16]Dataeye : 0x10000 [20]HW : 0x100000 [21]MPR : 0x200000 [22]AC : 0x400000 [24]Host Vref : 0x1000000 [25]Dram Vref : 0x2000000 [28]Dataeye Adjust : 0x10000000 [29]WL Write Adjust: 0x20000000 [30]HW Read Adjust : 0x40000000 DDR training fail machidUsing machid 0x%x from environment Starting kernel ... Can't add shutdown function,Please increase CFG_MAX_SHUTDOWN count resetting ... Error reading data FAT32 FAT12 FAT16 Invalid FAT entry ** Partition %d not valid on device %d ** UFATFAT32 %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: IDESATAATAPIUSBDOCMMCUnknown Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for UNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table Extd** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x 1 0 %10ld %2x %5d %10d %10d %2x%s hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%dPartition Start Sector Num Sectors Type Check Flash Memory Controller v100 ... Found Register dump: 0x%08X: %08X ERROR: index > length ERROR: USB HC TakeOver failed! ERROR: USB HC reset timed out! ERROR: sohci_submit_job: EPIPE ERROR: sohci_submit_job: URB NOT FINISHED ERROR: ep_add_ed: pending delete ERROR: sohci_submit_job: ENOMEM ERROR: need %d TDs, only have %d ERROR: sohci_submit_job: EINVAL ERROR: submit_common_message: pipesize for pipe %lx is zero ERROR: sohci_submit_job failed ERROR: %s device removed! ERROR: OHCI Unrecoverable Error, controller usb-%s disabled ERROR: CTL:TIMEOUT ERROR: submit_control_message: pipesize for pipe %lx is zero hiusb-ohci(fmt null) Hi3521Araise: Signal # %d caught -,h8<t  B((@B<P D <0 C PP\\ P$@Ў О\8`8(0 0  $  ( p , #0 /$0   R/8 0 002 S00700R  B/0 //// -D1s@-P0@SG`PE[U8 888(88888880][]00P %P P0PXS xS\0  @,Ѝp@Ѝ/d8N2S2Y2a2g2m2p2/0-\0 0cϠ?o2R  0  0\12 0\1 2P0@- @R0S * 0$$ 04eЍh8/s2//F-TM0@f P`00 06 |6|&0ppE P800=U00CS x  8      } @@P:PP 0%M@PU @PPP v@PUh @PnPP @PUP @PVPP @PU8  @P @P 0   $ 01@T$ PP  @PUpl#hd#{@4S040p@@ ,#0kp `]e#0P]V 0#>#3D`"Q`V 0?#3D`"C`V 0冑ᆣl!># 0  X"20@?# 0`    "$`V 0?#3D`!`V 0?#3D`!`V 0?#3D`!`V 0冑ᆣH?# 0  D!0"># 0`    !`V0 ?#3D` (!J?p 0c? 0h0 WGTTЍh8d802p802*02A03373V0@3Y3v3333344%434R/" 2RRR,SSS</| PQRS /12,3<! 00 0#P//0(20" 0O?/0S Hn0G4@-@ \\\ S   ^!^ 0b \0 8< 0 40Ѝ{@-00     Ѝ~0]4P 0090/# 0( !#/0/p0&6p p00)9 0O/F-`P@pP1 Z0(  p !(  Z Z>01>01,0 010D0(0 08p0p@W0!0 140OB-`t@ppPP 0T10(0 0p0,0 (01P@U0 0!4 !OS??ÓÓ $#N-`RMK@  P0UB  y Op㤐p W 0#΄ P  Z ^ 0PUZd\ 0P<Y 9 0 0-Ѝ044-#^\!./\/".0130S\!\" !0/PP/p@-`@P 0P0S20C6>0 010ol0U 80C000000D000pO0040000000000p04mmmmUU1@-O@00SS  0$  P# !r 0Rt0B‚1B!1! q 0001s 04`8@-P @uu0 S 0" ","v 10?qQ 0SLH Y 80,, Q 08400(5 5N-P M@ 봤尔K>tJ.d  00 A p`''P:97t6Dzyw *'x964:7$qpr s0P$ 41"(0q2$p3Dr t0 Ѝ0:5@-0Sp@` pP0%P0p  S@ 0d5N-M8@p piD0 p00 [ [ [PPD0 0P!D0 0 0{ 0pY W  D0 p 0 0  ЍF-@$M偑`Ppj {P% 0 0"0PP p00 0!_0s 1   p0,\\! 0LP 0"PP poQAp 0 <P 000 0"PP pSQp 0 P 00C0p  0 A0 c(0 0  p $Ѝ 1555N-@MP`p1A00 0 0 X 10#[Z@D [0  0p@ 0sp0  1 @TW㩑0?Ѝ 16SN-`0  V M??@ၣ3  Z 0 P  0RiV  PPp!0 00Pp@p`p ?40 0! 00] \\\ [ 0 ЍNLV[PPgU[PgPU P0: 0  ;P  0 0(, 000 Ѝ316J1J66n6s@-P ` P@0T m P P 0S@P 0Ѝp6^1q16F-`@pP0V `PU p@P< 0Z   Ѝ16@-`GMPp| x@h0F/p`` L0 0` 00 0p pGߍ71F-IM@`1. `@P000000.0U2*0@ㅒp 0 f0 10s#8 0p  @>TP0 0  03D@ 0P@R  0Iߍ1/7N- MP@A ":Qd ?0 0  `0VS 1# p2ς 2 0,   0  0 P[0Co[ pW[p0i!0`000p 0  0`  04 + k`0 ,2Z4 f "Q dqZ ЍP711b777N-PhM(#@$H (0 p`#R0 ^   d !( 0 D0#\ P R B  $# 0 d0 #2p0W2 00$D p $ #S  0Vd  `0R P S\OLP!0 PH, à`f42XS4`0$`p bSY`Pe!0 p 0W`p#Y#V`#*Pc!0  0WpepY eV`e`$ x\ 00#442XrbhЍ7171N-P"@M@|/0PS0p⏿`<0V 0 Y\ $ I0  0 Pl 렐0, S0`0J0  pWt W τ0S  P聀00 `@V@V㠐 0p0 `iV 6 0` 0X 00/ S Ñ@?0S 0` vF@Ѝ8228%2@81N-Aa29Cp,P倡0so p8p00  !0 0P@p>0h1 Wa@P<00 09@T P@"PU0 QiU အ0@ @ P  0@@ PhpdU>L01D0 QaU〡@$0TpU922{ddr_ddrt_get_test_addrddr_training_cmd_entryddr_gating_funcddr_vref_training_funcddr_ac_training_funcddr_training_cmd_resultddr_dmc_sfc_cmdddr_training_check_bypassddr_wl_processddr_ddrt_initddr_ddrt_testddr_hw_trainingddr_hw_dataeye_readddr_mpr_extractddr_dataeye_check_dqddr_dataeye_find_dqddr_dataeye_deskewddr_adjust_trend_checkddr_adjust_move_winddr_adjust_dataeyeddr_adjust_byteddr_dataeye_processddr_dataeye_trainingddr_mpr_find_rdqddr_mpr_trainingddr_mpr_find_rdqsddr_write_levelingddr_wl_bdl_syncddr_gate_trainingddr_gate_find_bdlddr_gate_find_phaseddr_sw_training_funcINFODEBUGWARNINGERRORFATAL0x DDRT test address[%x] out of range[%x, %x].DDR training command entry. Sysctl[%x = %x]PHY[%x] hw gating fail.Not support DDR vref training.Not support DDR AC training.DDR training result[%x]PHY[%x]:[%x = %x] WDQS Byte(%x) [%x = %x] WDQ Phase Byte(%x)[%x = %x] WDQ BDL DQ(%x-%x)[%x = %x] WDM Byte(%x)[%x = %x] Write DQ/DQS OE Byte(%x)[%x = %x] RDQS Byte(%x)[%x = %x] RDQ BDL DQ(%x-%x)[%x = %x] Gate Byte(%x)[%x = %x] CS[%x = %x] CLK[%x = %x] Host VrefSFC cmd wait timeout.DDR training itme[%x] is disable. Sysctl[%x = %x]PHY[%x] WL fail, result[%x]PHY[%x] WL not found phase, result[%x]DDRT[%x] init.DDRT wait timeout.DDR hardware training.Phy[%x] hw read dataeye failHWR wait timeout.byte[%x] data[%x=%x][%x=%x][%x=%x][%x=%x]DDR dataeye dq check type not set.DQ[%x] def[%x] nok, find new value[%x]DQ[%x] not found dq. restore[%x]DQ[%x] range: left[%x] right[%x]. best[%x] mode[%x]Byte[%x] DQ[%x] no win.byte[%x] bdl[%x] middle[%x] accel[%x] rdqs[%x]Move byte[%x] window to middle suc.Byte[%x] deskew fail, restore[%x].Move byte[%x] to middle fail. [%x]DDR dataeye adjust.PHY[%x] Byte[%x] mode[%x] win on middle.PHY[%x] mode[%x] dataeye training fail.DDR dataeye training.PHY[%x] Byte[%x] DQ[%x] MPR failDDR MPR training.PHY[%x] Byte[%x] rdqs_middle[%x]rdqs_start[%x] rdqs_end[%x]PHY[%x] Byte[%x] not find RDQS, restore.DDR Write Leveling training.Byte[%x] new[%x][%x] old[%x][%x]DDR Gate training.PHY[%x] find gate bdl fail. result[%x]find gate phase[%x] fail.|`x 4䒀$`4ddlf覃DvfܦDDܦDHܦDܦDEܦDF ܦDG@ܦD ܦD 쨃t,`D  쨃t,`0 @ܦD 쨃t,`0 Ԩ\ ̧H| ਃ\اx& ܦD!&ܦD-ܦD7ܦDA ܦDKMਃ\,H|DUܦD_M@ਃ\,𧃀H|Di@쨃ЦDs ਃ\HX0 ਃ\H|0 Mਃ\,𧃀HXD Mਃ\D䧃H|DMਃ\D䧃H|%ܦD%ܦD%A ܦD%J@ܦD%ܦD%ܦD%ܦD%ܦD 覃D 覃D ܦD ܦD# ܦD*  ܦD1 @쨃xD8 ܦD? dDG @ܦDO @ܦDW @ ܦD_ ܦDg  ܦDo @D0 ĦD, ȨP<pDw q 쨃8x$D q@쨃8x$D qܦD0ܦD0ܦD0ܦD0ܦD0 ܦD0@ܦD0ܦD@Ԩ,lD@ Ԩ,lD@@Ԩ,lD@Ԩ,lD@쨃\ H|D@Ԩ,H| 1D1 D0@Ԩ,䧃lD#0Ԩh,䧃l|0+0Ԩ\,䧃H|04Ah,Tृ=@T̥F@T̥N@@TDHdcgbHdc jbHdc jbHdcPkdHdc,lTfHdcabHdc,lbh2lhdVPKB@2R2Pl@lK@lhdVPKB@2kPlhTPP@;l;h;h;P;K;@ l h d V P K B @ 2B62(!   t t t  t @t t @$8J\X hت H =L X e p { = X     6R ?b ?nb     ,HeXpX}n     ,?eججଃଃ謃謃𬃀𬃀 ((0088@@HHPPXX``hhppxxȭȭЭЭححୃୃ譃譃𭃀𭃀 ((0088@@HHPPXX``hhppxxȮȮЮЮخخஃஃ讃讃𮃀𮃀 ((0088@@HHPPXX``hhppxxȯȯЯЯدد௃௃诃诃𯃀𯃀 ((0088@@HHPPXX``hhppxxȰȰааbootargs=mem=96M console=ttyAMA0,115200bootcmd=bootm 0x82000000bootdelay=1baudrate=115200ethaddr=00:00:23:34:45:66ipaddr=192.168.1.10serverip=192.168.1.2netmask=255.255.255.0bootfile="uImage"Q%Q%_)j)p)v)})))) t t ))))))))) )))))))) ****'**+*0* X%9* @*F* L*T*a*j*s*y*t t h(v((((((((((((()) )() <)E)t t (((+(0(@(E(U(Y(t t   ( w B:M B:M B:MB:MB:MB:MB:MB:MB:M   ~w|  8)~,8),8)X,(n(h,X,8),8)X,@, @$ z># `X *#()h2pVdFP HH$hpHX,1@B p0 % P0 @7 ^#pRX pRX  @?1<;